PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC04G21620.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRF
Protein Properties Length: 386aa    MW: 41414.2 Da    PI: 7.9345
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC04G21620.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.28e-25114158145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  OPUNC04G21620.1 114 DPEPGRCRRTDGKKWRCSKEAAPDSKYCERHMHRGRNRSRKPVEA 158
                      79****************************************996 PP

2QLQ591.4e-205388237
              QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                     +FTaaQ ++L++Q+l+yKyL+a++PvP++Ll++i++
  OPUNC04G21620.1 53 PFTAAQYEELEQQALIYKYLVAGVPVPADLLLPIRR 88
                     9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.4E-115288IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.1875388IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.0E-145387IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.517114158IPR014977WRC domain
PfamPF088793.9E-21115157IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MAMPFASLSP AADHRPSSIF PFCRSSPLSA VGEEAQQHMM GARWAAAVAR PPPFTAAQYE  60
ELEQQALIYK YLVAGVPVPA DLLLPIRRGL DSLASRFYHH PVLGYGSYFG KKLDPEPGRC  120
RRTDGKKWRC SKEAAPDSKY CERHMHRGRN RSRKPVEAQL VAPHSQPPAT APAAAVTSTA  180
FQNHSLYPAI ANGGGAGGGG GGGGGGGNAP GSFALGSNTQ LHMDNAASYS TVAGAGNKDF  240
RYSAYGVRPL ADEHSPLITG AMDTSIDNSW RLLPSQTSTF SVSSYPMLGN LSELDQNTIC  300
SLPKADREPL SFFGSDYVSV DSGKQENQTL RPFFDEWPKA RDSWPELADD NSLATFSATQ  360
LSISIPMATS DFSSTSSRSP NGIYSR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ5466930.0FJ546693.1 Oryza sativa Indica Group cultivar IR58 growth-regulating factor 3 (GRF3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634332.10.0PREDICTED: growth-regulating factor 3 isoform X1
RefseqXP_015634333.10.0PREDICTED: growth-regulating factor 3 isoform X2
SwissprotQ6AWY60.0GRF3_ORYSJ; Growth-regulating factor 3
TrEMBLA0A0E0KUR10.0A0A0E0KUR1_ORYPU; Uncharacterized protein
STRINGLOC_Os04g51190.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA014417-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24633476
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-46growth-regulating factor 5